CDS

Accession Number TCMCG037C24720
gbkey CDS
Protein Id XP_022154956.1
Location complement(join(64350..64523,64628..>64684))
Gene LOC111022099
GeneID 111022099
Organism Momordica charantia

Protein

Length 104aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA397875
db_source XM_022299264.1
Definition thiamine thiazole synthase 2, chloroplastic [Momordica charantia]

EGGNOG-MAPPER Annotation

COG_category H
Description Involved in biosynthesis of the thiamine precursor thiazole. Catalyzes the conversion of NAD and glycine to adenosine diphosphate 5-(2-hydroxyethyl)-4-methylthiazole-2-carboxylic acid (ADT), an adenylated thiazole intermediate. The reaction includes an iron-dependent sulfide transfer from a conserved cysteine residue of the protein to a thiazole intermediate. The enzyme can only undergo a single turnover, which suggests it is a suicide enzyme. May have additional roles in adaptation to various stress conditions and in DNA damage tolerance
KEGG_TC -
KEGG_Module -
KEGG_Reaction R10685        [VIEW IN KEGG]
KEGG_rclass RC00033        [VIEW IN KEGG]
RC03253        [VIEW IN KEGG]
RC03254        [VIEW IN KEGG]
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
KEGG_ko ko:K03146        [VIEW IN KEGG]
EC -
KEGG_Pathway ko00730        [VIEW IN KEGG]
ko01100        [VIEW IN KEGG]
map00730        [VIEW IN KEGG]
map01100        [VIEW IN KEGG]
GOs GO:0003674        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005506        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005829        [VIEW IN EMBL-EBI]
GO:0006725        [VIEW IN EMBL-EBI]
GO:0006766        [VIEW IN EMBL-EBI]
GO:0006767        [VIEW IN EMBL-EBI]
GO:0006772        [VIEW IN EMBL-EBI]
GO:0006790        [VIEW IN EMBL-EBI]
GO:0006807        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0009058        [VIEW IN EMBL-EBI]
GO:0009110        [VIEW IN EMBL-EBI]
GO:0009228        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0017144        [VIEW IN EMBL-EBI]
GO:0018130        [VIEW IN EMBL-EBI]
GO:0018131        [VIEW IN EMBL-EBI]
GO:0019438        [VIEW IN EMBL-EBI]
GO:0034641        [VIEW IN EMBL-EBI]
GO:0042364        [VIEW IN EMBL-EBI]
GO:0042723        [VIEW IN EMBL-EBI]
GO:0042724        [VIEW IN EMBL-EBI]
GO:0043167        [VIEW IN EMBL-EBI]
GO:0043169        [VIEW IN EMBL-EBI]
GO:0044237        [VIEW IN EMBL-EBI]
GO:0044249        [VIEW IN EMBL-EBI]
GO:0044271        [VIEW IN EMBL-EBI]
GO:0044272        [VIEW IN EMBL-EBI]
GO:0044281        [VIEW IN EMBL-EBI]
GO:0044283        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0046483        [VIEW IN EMBL-EBI]
GO:0046484        [VIEW IN EMBL-EBI]
GO:0046872        [VIEW IN EMBL-EBI]
GO:0046914        [VIEW IN EMBL-EBI]
GO:0052837        [VIEW IN EMBL-EBI]
GO:0052838        [VIEW IN EMBL-EBI]
GO:0071704        [VIEW IN EMBL-EBI]
GO:0072527        [VIEW IN EMBL-EBI]
GO:0072528        [VIEW IN EMBL-EBI]
GO:1901360        [VIEW IN EMBL-EBI]
GO:1901362        [VIEW IN EMBL-EBI]
GO:1901564        [VIEW IN EMBL-EBI]
GO:1901566        [VIEW IN EMBL-EBI]
GO:1901576        [VIEW IN EMBL-EBI]

Sequence

CDS:  
CCCGGTATGATCGTCACCGGCATGGAGGTCGCCGAGATCGACGGAGCTCCAAGAATGGGACCGACTTTCGGGGCGATGATGATATCAGGGCAGAAGGCGGCGCACTTGGCACTGAAGTCATTGGGGCTGGGGAACGCCATAGATGGAGAAAGAAAGAAAGTGGAAATGAAGGATGAAGAAGCAGAGCTGCTAATCGCGGCGGCGGAATCGCCGGAGGTTGCAGATGCTTGA
Protein:  
MIDSVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGLGNAIDGERKKVEMKDEEAELLIAAAESPEVADA